Loading...
Statistics
Advertisement

FMA - Future Media Architects
www.3277.org/

3277.org

Advertisement
Conversion Technology Metas Server
3277.org is hosted in United States / San Antonio . 3277.org uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 7. First javascripts: Jquery-1.4.4.min.js, Script.js, Jquery.flow.1.2.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.2.15 (Red Hat).

Technologies in use by 3277.org

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 7
  • jquery-1.4.4.min.js
  • script.js
  • jquery.flow.1.2.min.js
  • jquery.corner.js
  • thickbox.js
  • jcarousellite_1.0.1.js
  • crawler.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.2.15 (Red Hat)

Powered by

  • PHP/5.3.3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 3277.org

SSL certificate

    • name: /C=--/ST=SomeState/L=SomeCity/O=SomeOrganization/OU=SomeOrganizationalUnit/CN=localhost.localdomain/emailAddress=root@localhost.localdomain
    • subject:
      • C: --
      • ST: SomeState
      • L: SomeCity
      • O: SomeOrganization
      • OU: SomeOrganizationalUnit
      • CN: localhost.localdomain
      • emailAddress: root@localhost.localdomain
    • hash: da4d55fe
    • issuer:
      • C: --
      • ST: SomeState
      • L: SomeCity
      • O: SomeOrganization
      • OU: SomeOrganizationalUnit
      • CN: localhost.localdomain
      • emailAddress: root@localhost.localdomain
    • version: 2
    • serialNumber: 4331
    • validFrom: 130520135612Z
    • validTo: 140520135612Z
    • validFrom_time_t: 1369058172
    • validTo_time_t: 1400594172
    • extensions:
      • subjectKeyIdentifier: CE:91:45:15:F4:1E:26:DD:7A:B1:CB:10:78:61:06:C1:2B:1F:0C:AB
      • authorityKeyIdentifier: keyid:CE:91:45:15:F4:1E:26:DD:7A:B1:CB:10:78:61:06:C1:2B:1F:0C:AB
      • basicConstraints: CA:TRUE

Meta - 3277.org

Number of occurences: 1
  • Name:
    Content: text/html; charset=UTF-8

Server / Hosting

  • IP: 50.57.34.52
  • Latitude: 29.49
  • Longitude: -98.40
  • Country: United States
  • City: San Antonio

Rname

  • ns1.fma.net
  • ns2.fma.net

Target

  • hostmaster.rackspace.com

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 26 Jul 2016 17:36:23 GMT Server: Apache/2.2.15 (Red Hat) X-Powered-By: PHP/5.3.3 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: 3277.org
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 50.57.34.52
host: 3277.org
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns1.fma.net
host: 3277.org
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns2.fma.net
host: 3277.org
  1. class: IN
  2. ttl: 300
  3. type: SOA
  4. mname: ns.rackspace.com
  5. rname: hostmaster.rackspace.com
  6. serial: 1343655778
  7. refresh: 3600
  8. retry: 300
  9. expire: 1814400
  10. minimum-ttl: 300
host: 3277.org
  1. class: IN
  2. ttl: 300
  3. type: TXT
  4. txt: v=spf1 a ip4:50.57.34.52 -all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.277.org, www.3q277.org, www.q277.org, www.3w277.org, www.w277.org, www.3e277.org, www.e277.org, www.3277.org, www.277.org, www.31277.org, www.1277.org, www.377.org, www.32077.org, www.3077.org, www.32q77.org, www.3q77.org, www.32w77.org, www.3w77.org, www.327.org, www.327t7.org, www.32t7.org, www.327z7.org, www.32z7.org, www.327y7.org, www.32y7.org, www.327u7.org, www.32u7.org, www.32757.org, www.3257.org, www.327.org, www.3277t.org, www.327t.org, www.3277z.org, www.327z.org, www.3277y.org, www.327y.org, www.3277u.org, www.327u.org, www.32775.org, www.3275.org,

Other websites we recently analyzed

  1. Service4Logistic
    Poland - 79.96.238.137
    Server software: IdeaWebServer/v0.80
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 2
    Number of meta tags: 4
  2. cnfocus
    Beijing (China) - 114.113.158.13
    Server software: Apache/2.2.8 (Win32) PHP/5.2.6
    Technology: CSS, Html, Php
    Number of Javascript: 2
    Number of meta tags: 2
  3. 拉索城堡官方网站
    拉索城堡-----世界因我而不同，官方客服电话：4006-120-289。1
    Central District (Hong Kong) - 121.127.234.105
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 3
    Number of meta tags: 3
  4. iri.hs.kr
    Korea, Republic of - 211.210.30.141
    Server software:
    Technology: Javascript
  5. saltlakevalleycarpetcleaning.info
    Scottsdale (United States) - 184.168.221.42
    Server software:
    Technology: Html, Html5, Iframe
  6. Zenfolio | JL Photo & Design
    Jessica Lingenfelter Photography & Design provides graphic design work and artistic pictures and portraits with a modern and vintage flair. See our website for portfolios and pricing. Located in Neosho, MO.
    Europe - 95.100.248.121
    Server software:
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  7. maplelab
    Italy - 92.223.209.197
    Server software: Microsoft-IIS/7.5
    Technology: Html, Javascript, Google Analytics
    Number of meta tags: 2
  8. Дом здоровья "Оберег"
    Дом здоровья "Оберег"
    Russian Federation - 185.42.12.3
    Server software: nginx/1.0.15
    Technology: Carousel, CSS, Html, Javascript, jQuery, Php, LiveInternet counter
    Number of Javascript: 8
    Number of meta tags: 4
  9. MMM Investments
    India - 103.241.181.75
    Server software: Microsoft-IIS/8.0
    Technology: CSS, Html
  10. CSTL - Colloque santé des troupeaux laitiers
    CSTL est une organisation sans but lucratif afin de promouvoir la santé pour les troupeaux laitiers
    Saint-hyacinthe (Canada) - 24.226.183.176
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript
    Number of meta tags: 3

Check Other Websites